Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0719125_circ_g.3 |
| ID in PlantcircBase | osa_circ_003667 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 29966253-29966746 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0719100 |
| Parent gene annotation |
Similar to RING finger and CHY zinc finger domain-containing pro tein 1. (Os01t0719100-01);Similar to PGPD14 protein. (Os01t07191 00-02);Hypothetical gene. (Os01t0719100-03);RING zinc-finger pro tein, Stomata opening (Os01t0719100-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0719125-00:3 Os01t0719100-02:3 Os01t0719100-04:3 Os01t0719125-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002359* |
| PMCS | 0.169843573 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29966686-29966480(+) 29966695-29966731(-) |
| Potential amino acid sequence |
MMHRSFNTCMTVLQYYRITASILLSQVSDIVASSSSNLSHAFDMSQTDLEQSGQANWQCSSISR KHLT*(+) MHHDCPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEHCQFACPLCSKSVCDMSKAWERLDEE LATISDTCDNKMDAVIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |