Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0719125_circ_g.3 |
ID in PlantcircBase | osa_circ_003667 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 29966253-29966746 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0719100 |
Parent gene annotation |
Similar to RING finger and CHY zinc finger domain-containing pro tein 1. (Os01t0719100-01);Similar to PGPD14 protein. (Os01t07191 00-02);Hypothetical gene. (Os01t0719100-03);RING zinc-finger pro tein, Stomata opening (Os01t0719100-04) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0719125-00:3 Os01t0719100-02:3 Os01t0719100-04:3 Os01t0719125-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002359* |
PMCS | 0.169843573 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29966686-29966480(+) 29966695-29966731(-) |
Potential amino acid sequence |
MMHRSFNTCMTVLQYYRITASILLSQVSDIVASSSSNLSHAFDMSQTDLEQSGQANWQCSSISR KHLT*(+) MHHDCPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEHCQFACPLCSKSVCDMSKAWERLDEE LATISDTCDNKMDAVIL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |