Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA000905_circ_g.2 |
ID in PlantcircBase | osi_circ_002359 |
Alias | 1:33193137|33193630 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 33193137-33193630 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA000905 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA000905_circ_igg.1 BGIOSGA000905_circ_igg.2 BGIOSGA000905_circ_igg.3 BGIOSGA000905_circ_g.1 BGIOSGA000905_circ_g.3 BGIOSGA000905_circ_g.4 BGIOSGA000905_circ_igg.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA000905-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_003667* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33193579-33193615(-) 33193570-33193364(+) |
Potential amino acid sequence |
MHHDCPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEHCHLKLMLRFACPLCSKSVCDMSKAW ERLDEELATISDTCDNKMDAVIL*(-) MMHRSFNTCMTVLQYYRITASILLSQVSDIVASSSSNLSHAFDMSQTDLEQSGQANLSINFKWQ CSSISRKHLT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |