Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0363500_circ_g.2 |
ID in PlantcircBase | osa_circ_019926 |
Alias | Os_ciR1421 |
Organism | Oryza sativa |
Position | chr3: 14156016-14156295 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
Parent gene | Os03g0363500 |
Parent gene annotation |
Similar to Vacuolar monosaccharide symporter 1. (Os03t0363500-01 );Similar to Sugar transporter-like protein. (Os03t0363500-02);S imilar to solute carrier family 2, facilitated glucose transport er member 8. (Os03t0363500-03) |
Parent gene strand | - |
Alternative splicing | Os03g0363500_circ_g.1 |
Support reads | 17/3 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0363500-01:1 Os03t0363500-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004837* osi_circ_013055 |
PMCS | 0.554165387 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14156087-14156275(-) 14156059-14156275(-) |
Potential amino acid sequence |
MVFQQLGGINALGFYTSYIFSSAGIYRITS*(-) MPWDFIQAISFPLQEYIESLRSLPEARVQDLFQRKNLFAVIVGVGLMVFQQLGGINALGFYTSY IFSSAGIYRITS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |