Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA010686_circ_g.2 |
| ID in PlantcircBase | osi_circ_004837 |
| Alias | 3:15693941|15694220 |
| Organism | Oryza sativa ssp. indica |
| Position | chr3: 15693941-15694220 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA010686 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA010686_circ_g.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA010686-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_019926* osa_circ_019925 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15694012-15694200(-) 15693984-15694200(-) |
| Potential amino acid sequence |
MVFQQLGGINALGFYTSYIFSSAGIYRITS*(-) MPWDFIQAISFPLQEYIESLRSLPEARVQDLFQRKNLFAVIVGVGLMVFQQLGGINALGFYTSY IFSSAGIYRITS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |