Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0155400_circ_g.2 |
ID in PlantcircBase | osa_circ_035900 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 3188693-3189291 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ie-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0155550 |
Parent gene annotation |
Hypothetical protein. (Os08t0155550-00) |
Parent gene strand | + |
Alternative splicing | Os08g0155400_circ_g.3 Os08g0155400_circ_g.4 Os08g0155400_circ_g.5 |
Support reads | 5 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0155400-01:1 Os08t0155550-00:1 Os08t0155400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007539* osi_circ_018203 |
PMCS | 0.555377671 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3189194-3189287(-) |
Potential amino acid sequence |
MGVLYLALYLTALGTGGLKSSVSGFGSDQFDESDSGEKSQMMRFFNWFFFFISLGSLLAVTVLV YVQDNLGRPWGYGACAAAIAAGLVVFLAGTRRYRFKKLVGSPLTQIAAVVVAAWRKRRLELPSD PAMLYDIDVGKLAAAEVELAASSKKSKLKQRLPHTKQFRG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |