Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G41100_circ_g.3 |
| ID in PlantcircBase | ath_circ_017730 |
| Alias | At_ciR10, AT2G41100_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 17138307-17138573 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, CIRI, CIRI-full, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, circseq_cup, find_circ, CIRI2 |
| Parent gene | AT2G41100 |
| Parent gene annotation |
Calmodulin-like protein 12 |
| Parent gene strand | + |
| Alternative splicing | AT2G41090_circ_g.1 AT2G41090_circ_g.2 AT2G41090_circ_g.3 2_circ_ag.4 2_circ_ag.5 2_circ_ag.6 AT2G41090_circ_g.7 AT2G41100_circ_g.1 AT2G41100_circ_g.2 AT2G41100_circ_g.4 AT2G41100_circ_g.5 AT2G41100_circ_g.6 AT2G41100_circ_g.7 AT2G41100_circ_g.8 |
| Support reads | 5/1319/1001 |
| Tissues | siliques and seeds/leaf/root, leaf, aerial, inflorescences, seed, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G41100.3:1 AT2G41100.1:1 AT2G41100.2:1 AT2G41100.4:1 AT2G41100.6:1 AT2G41100.7:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.976501907 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17138336-17138570(+) |
| Potential amino acid sequence |
MMRSIGEKPTKADLQDLMNEADLDGDGTIDFPEFLCVMAKNQGHDQAPRHTKKTMADKLTDDQI TEYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGTIDFPEFLCVMA KNQGHDQAPRHTKKTMADKLTDDQITEYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADL QDLMNEADLDGDGTIDFPEFLCVMAKNQGHDQAPRHTKKTMADKLTDDQITEYRESFRLFDKNG DGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGTIDFPEFLCVMAKNQGHDQAPRHTKK TMADKLTDDQITEYRESFRLFDKNGD(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |