Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G41100_circ_g.7 |
| ID in PlantcircBase | ath_circ_017734 |
| Alias | At_ciR238 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 17138674-17138943 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT2G41100 |
| Parent gene annotation |
Calmodulin-like protein 12 |
| Parent gene strand | + |
| Alternative splicing | AT2G41090_circ_g.1 AT2G41090_circ_g.2 AT2G41090_circ_g.3 2_circ_ag.4 2_circ_ag.5 2_circ_ag.6 AT2G41090_circ_g.7 AT2G41100_circ_g.1 AT2G41100_circ_g.2 AT2G41100_circ_g.3 AT2G41100_circ_g.4 AT2G41100_circ_g.5 AT2G41100_circ_g.6 AT2G41100_circ_g.8 |
| Support reads | 10/372 |
| Tissues | leaf/leaf, aerial, seed, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G41105.1:1 AT2G41100.2:1 AT2G41100.1:1 AT2G41105.1:1 AT2G41100.4:1 AT2G41100.7:1 AT2G41100.6:1 AT2G41100.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.80811401 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17138706-17138940(+) |
| Potential amino acid sequence |
MFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMAKNQGHDQAPRHTKKTMVDYQLTDDQI LEFREAFRVFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMA KNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGSITKKELRTVMFSLGKNRTKAD LQDMMNEVDLDGDGTIDFPEFLYLMAKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDK NGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMAKNQGHDQAPRHT KKTMVDYQLTDDQILEFREAFRVFDKNGD(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |