Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G41100_circ_g.7 |
ID in PlantcircBase | ath_circ_017734 |
Alias | At_ciR238 |
Organism | Arabidpsis thaliana |
Position | chr2: 17138674-17138943 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT2G41100 |
Parent gene annotation |
Calmodulin-like protein 12 |
Parent gene strand | + |
Alternative splicing | AT2G41090_circ_g.1 AT2G41090_circ_g.2 AT2G41090_circ_g.3 2_circ_ag.4 2_circ_ag.5 2_circ_ag.6 AT2G41090_circ_g.7 AT2G41100_circ_g.1 AT2G41100_circ_g.2 AT2G41100_circ_g.3 AT2G41100_circ_g.4 AT2G41100_circ_g.5 AT2G41100_circ_g.6 AT2G41100_circ_g.8 |
Support reads | 10/372 |
Tissues | leaf/leaf, aerial, seed, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G41105.1:1 AT2G41100.2:1 AT2G41100.1:1 AT2G41105.1:1 AT2G41100.4:1 AT2G41100.7:1 AT2G41100.6:1 AT2G41100.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.80811401 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17138706-17138940(+) |
Potential amino acid sequence |
MFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMAKNQGHDQAPRHTKKTMVDYQLTDDQI LEFREAFRVFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMA KNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGSITKKELRTVMFSLGKNRTKAD LQDMMNEVDLDGDGTIDFPEFLYLMAKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDK NGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMAKNQGHDQAPRHT KKTMVDYQLTDDQILEFREAFRVFDKNGD(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |