Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0259600_circ_g.10 |
| ID in PlantcircBase | osa_circ_001198 |
| Alias | Os01circ08048/Os_ciR4548 |
| Organism | Oryza sativa |
| Position | chr1: 8706231-8706394 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os01g0259600 |
| Parent gene annotation |
Similar to phosphoadenosine phosphosulfate (PAPS) reductase fami ly protein. (Os01t0259600-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0259600_circ_g.1 Os01g0259600_circ_g.2 Os01g0259600_circ_g.3 Os01g0259600_circ_g.4 Os01g0259600_circ_g.5 Os01g0259600_circ_g.6 Os01g0259600_circ_g.7 Os01g0259600_circ_g.8 Os01g0259600_circ_g.9 |
| Support reads | 2/4/3/3 |
| Tissues | leaf/root/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0259600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.56575752 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8706330-8706327(-) 8706248-8706344(-) |
| Potential amino acid sequence |
MNTIQNCPVRTIYFESPCAFPEINSFTYETVSTFCCIYFGLATTSTNQALMVKSK*(-) MKLSQRSVAFTSGWLLPPQIKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |