Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0259600_circ_g.7 |
| ID in PlantcircBase | osa_circ_001195 |
| Alias | Os_ciR1420 |
| Organism | Oryza sativa |
| Position | chr1: 8704154-8704615 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os01g0259600 |
| Parent gene annotation |
Similar to phosphoadenosine phosphosulfate (PAPS) reductase fami ly protein. (Os01t0259600-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0259600_circ_g.1 Os01g0259600_circ_g.2 Os01g0259600_circ_g.3 Os01g0259600_circ_g.4 Os01g0259600_circ_g.5 Os01g0259600_circ_g.6 Os01g0259600_circ_g.8 Os01g0259600_circ_g.9 Os01g0259600_circ_g.10 |
| Support reads | 17/3 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0259600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011485 |
| PMCS | 0.502767929 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8704316-8704603(-) 8704525-8704603(-) |
| Potential amino acid sequence |
MVFLVGGLGPLHSDISLAGVAKAFGVRLVRHS*(-) MKLILLLKKLNVANLQMTWCFLLEDLGLYIQTFRWLALQKHLEFVWFGTVEDKLGAGLCKKLHA IGWRVSHVAVVSNEIDSVAEEVERCKSTDDMVFLVGGLGPLHSDISLAGVAKAFGVRLVRHS*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |