Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0409100_circ_g.2 |
ID in PlantcircBase | osa_circ_033473 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 12752338-12752652 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0409100 |
Parent gene annotation |
Similar to CLB1. (Os07t0409100-01) |
Parent gene strand | + |
Alternative splicing | Os07g0409100_circ_g.1 Os07g0409100_circ_g.3 Os07g0409100_circ_g.4 Os07g0409100_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0409100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.377786931 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12752429-12752401(+) 12752377-12752373(+) 12752349-12752557(-) |
Potential amino acid sequence |
MLLLHHFLFSSKIFKSTPLSVLYFNYQRRSLASLLLLLLFLQRYSHSKYSARPNHNGYRSSLGW *(+) MDIDLRWGGDPSIILAVDAVVASLPIQLKDLQVYTIVRVVFQLSEEIPCISAVVVALLAEVFAF KIFSQAKS*(+) MRIPLQEEQQQQQRCKGSPLIVEIQHGQWCRLEDL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |