Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0608100_circ_g.5 |
| ID in PlantcircBase | osa_circ_025136 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 30767957-30769406 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0608100 |
| Parent gene annotation |
Ribosomal protein S5 domain 2-type fold domain containing protei n. (Os04t0608100-01);Similar to OSIGBa0113I13.15 protein. (Os04t 0608100-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0608100_circ_g.2 Os04g0608100_circ_g.3 Os04g0608100_circ_g.4 |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0608100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.103160776 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30769297-30767980(+) 30768321-30769384(-) |
| Potential amino acid sequence |
MIDVSPQRANPVGASNHPDLSCTPSTNLHYLCSNNIKLNRITPSN*(+) MTINYGVLLGFVASDDAEISLQSGQFEGVIRFSLMLFEQR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |