Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0608100_circ_g.5 |
ID in PlantcircBase | osa_circ_025136 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 30767957-30769406 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os04g0608100 |
Parent gene annotation |
Ribosomal protein S5 domain 2-type fold domain containing protei n. (Os04t0608100-01);Similar to OSIGBa0113I13.15 protein. (Os04t 0608100-02) |
Parent gene strand | - |
Alternative splicing | Os04g0608100_circ_g.2 Os04g0608100_circ_g.3 Os04g0608100_circ_g.4 |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0608100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.103160776 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30769297-30767980(+) 30768321-30769384(-) |
Potential amino acid sequence |
MIDVSPQRANPVGASNHPDLSCTPSTNLHYLCSNNIKLNRITPSN*(+) MTINYGVLLGFVASDDAEISLQSGQFEGVIRFSLMLFEQR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |