Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d039041_circ_g.2 |
ID in PlantcircBase | zma_circ_009178 |
Alias | zma_circ_0002428, GRMZM2G101515_C1 |
Organism | Zea mays |
Position | chr6: 169134174-169134811 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d039041 |
Parent gene annotation |
Putative DUF1296 domain containing family protein |
Parent gene strand | + |
Alternative splicing | Zm00001d039041_circ_g.1 Zm00001d039041_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d039041_T004:2 Zm00001d039041_T008:2 Zm00001d039041_T002:2 Zm00001d039041_T009:2 Zm00001d039041_T007:2 Zm00001d039041_T005:2 Zm00001d039041_T003:2 Zm00001d039041_T006:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.197313354 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
169134597-169134224(+) |
Potential amino acid sequence |
MLGANMENVDAPSVSQANELRQDVLDPSELQYDVPSVPSHAYSNTDTLQPSTIEEPQGNNQAHT LSHLSNLMLRIPVLMYQQQQQTSRV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |