Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0235300_circ_g.1 |
| ID in PlantcircBase | osa_circ_027116 |
| Alias | Os_ciR10288 |
| Organism | Oryza sativa |
| Position | chr5: 8271229-8272895 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0235300 |
| Parent gene annotation |
Serine/threonine (Ser/Thr) protein kinase, Modulation of thylako id membrane lipid biosynthesis, homeostasis (Os05t0235300-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0235300_circ_g.2 Os05g0235300_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0235300-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.134425525 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8271248-8271349(+) 8271352-8272882(-) |
| Potential amino acid sequence |
MAAVADADVGVRSSVFKALYRNPSFDDFLAQADIMTSIFVALNDEEYHVRELAISVAGRLSEKN PAYVLPALRRYLIQLLTYLDQSMDSKCREESARLLGCLIRSCARLILPYIAPIHKALVARLREG TGPNANNALAAGVLATVGELAKVGGFAMRQYLPELMPLVVDALLDGGAVSKREVAVATLGQVIQ STGLWRNFLWLQLLMLMLVLEVLYSRLYIGIHLLMIFWPKLTS*(+) MMSAWAKKSSKDGFRYRALNTELLTPTSASATAAIRSFSTILCFG*(-) |
| Sponge-miRNAs | osa-miR6253 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |