Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0152700_circ_g.1 |
ID in PlantcircBase | osa_circ_010498 |
Alias | Os12circ00529/Os_ciR2163 |
Organism | Oryza sativa |
Position | chr12: 2597049-2598148 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
Parent gene | Os12g0152700 |
Parent gene annotation |
Amino acid-binding ACT domain containing protein. (Os12t0152700- 01);Similar to ACT domain containing protein. (Os12t0152700-02) |
Parent gene strand | - |
Alternative splicing | Os12g0152700_circ_g.2 |
Support reads | 3/6/30 |
Tissues | leaf/root/root, seed, pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0152700-01:5 Os12t0152700-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003291* osi_circ_010064 |
PMCS | 0.174909652 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2598146-2597347(+) 2597916-2598114(-) |
Potential amino acid sequence |
MSSFRSIIFNNYMCYNININLLLRSFYSKKFTHG*(+) MKALKDLGLDVTKGSVSTESAVTQTKFHIMRSGRKVEDPDTLEKIRLTVINNLLQYHPESSENL AMGEFFGIKAPEKKVDVDVVTHVIVEDDGPKRRHLMMQFHSQLF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |