Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0152700_circ_g.1 |
| ID in PlantcircBase | osa_circ_010498 |
| Alias | Os12circ00529/Os_ciR2163 |
| Organism | Oryza sativa |
| Position | chr12: 2597049-2598148 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os12g0152700 |
| Parent gene annotation |
Amino acid-binding ACT domain containing protein. (Os12t0152700- 01);Similar to ACT domain containing protein. (Os12t0152700-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0152700_circ_g.2 |
| Support reads | 3/6/30 |
| Tissues | leaf/root/root, seed, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0152700-01:5 Os12t0152700-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003291* osi_circ_010064 |
| PMCS | 0.174909652 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2598146-2597347(+) 2597916-2598114(-) |
| Potential amino acid sequence |
MSSFRSIIFNNYMCYNININLLLRSFYSKKFTHG*(+) MKALKDLGLDVTKGSVSTESAVTQTKFHIMRSGRKVEDPDTLEKIRLTVINNLLQYHPESSENL AMGEFFGIKAPEKKVDVDVVTHVIVEDDGPKRRHLMMQFHSQLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |