Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0255100_circ_g.1 |
| ID in PlantcircBase | osa_circ_014129 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 8763776-8764355 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0255100 |
| Parent gene annotation |
Mitochondrial protein phosphatase 2C protein 13, Pollen germinat ion (Os02t0255100-01);Similar to Catalytic/ protein phosphatase type 2C/ protein serine/threonine phosphatase. (Os02t0255100-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0255100_circ_g.2 Os02g0255100_circ_g.3 Os02g0255100_circ_g.4 Os02g0255100_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0255100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.320587859 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8763832-8763789(+) 8763834-8764253(-) |
| Potential amino acid sequence |
MEDFYDVKLTEIDGQAVSLFGVFDGHGGPRAAEYLKENLFENLLKHPEFLTDTKLAISETYQKT DTDFLESESNAFRDDGSTASTAVLVGGHLYVANVGDSRAVVSKAGKEKMVN*(+) MVALFPLKLEYPHFSLPSSLYQLLKQQHGNHQHLLHIDGHPPKLQWKLLNHHP*(-) |
| Sponge-miRNAs | osa-miR2093-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |