Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0255100_circ_g.5 |
ID in PlantcircBase | osa_circ_014133 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 8764936-8765641 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0255100 |
Parent gene annotation |
Mitochondrial protein phosphatase 2C protein 13, Pollen germinat ion (Os02t0255100-01);Similar to Catalytic/ protein phosphatase type 2C/ protein serine/threonine phosphatase. (Os02t0255100-02) |
Parent gene strand | + |
Alternative splicing | Os02g0255100_circ_g.1 Os02g0255100_circ_g.2 Os02g0255100_circ_g.3 Os02g0255100_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0255100-01:3 Os02t0255100-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.154277231 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8765581-8764963(+) 8764939-8765270(+) |
Potential amino acid sequence |
MKTWNASFLLAMDFGMSWKMSYGTVRRSQT*(+) MALSEDHKPNRSDERKRIENAGGVVIWAGTWRVGGVLAMSRAFGNRLLKPFVVAEPEIQEELVN EDLECLVLASDGLWDVVENELWHCQKITNLTGVMSGRELKMQEELSFGLVLGG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |