Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d041070_circ_g.7 |
ID in PlantcircBase | zma_circ_007601 |
Alias | zma_circ_0001515 |
Organism | Zea mays |
Position | chr3: 94787222-94790667 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d041070 |
Parent gene annotation |
5-methylthioadenosine/S-adenosylhomocysteine deaminase |
Parent gene strand | + |
Alternative splicing | Zm00001d041070_circ_igg.1 Zm00001d041070_circ_igg.2 Zm00001d041070_circ_g.1 Zm00001d041070_circ_g.2 Zm00001d041070_circ_g.3 Zm00001d041070_circ_g.4 Zm00001d041070_circ_g.5 Zm00001d041070_circ_g.6 Zm00001d041070_circ_g.8 Zm00001d041070_circ_g.9 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d041070_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.059001074 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
94790281-94788496(+) |
Potential amino acid sequence |
MVPLHDSIANIVYCMRTENIESVMCNGRWIMKDHKIMNLNEIGFFSKAGVKVSHCPASAMRMLG FAPIREMLDSGVCVSLGTDGAPSNNRMSIVDEMYLASLINKGREAYISGTTNPTALPAETVLKM ATINGAKAVLWDNEIGSLEVGKKVMLSVASLFMYSSQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |