Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0607400_circ_g.19 |
ID in PlantcircBase | osa_circ_002543 |
Alias | Os_ciR5897 |
Organism | Oryza sativa |
Position | chr1: 23944735-23945660 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0607400 |
Parent gene annotation |
Similar to STYLOSA protein. (Os01t0607400-01);Similar to STYLOSA protein. (Os01t0607400-02) |
Parent gene strand | - |
Alternative splicing | Os01g0607400_circ_g.11 Os01g0607400_circ_g.12 Os01g0607400_circ_g.13 Os01g0607400_circ_g.14 Os01g0607400_circ_g.15 Os01g0607400_circ_g.16 Os01g0607400_circ_g.17 Os01g0607400_circ_g.18 Os01g0607400_circ_g.20 Os01g0607400_circ_g.21 Os01g0607400_circ_ag.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0607400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21935495 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23945601-23944937(+) 23944797-23945628(-) |
Potential amino acid sequence |
MLSTTLRLNQVVVQHSLHIFAWTPINDPSGPADLGVKMGFISVLIL*(+) MNPILTPRSAGPEGSFIGVQAKIWRECWTTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |