Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0607400_circ_g.19 |
| ID in PlantcircBase | osa_circ_002543 |
| Alias | Os_ciR5897 |
| Organism | Oryza sativa |
| Position | chr1: 23944735-23945660 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0607400 |
| Parent gene annotation |
Similar to STYLOSA protein. (Os01t0607400-01);Similar to STYLOSA protein. (Os01t0607400-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0607400_circ_g.11 Os01g0607400_circ_g.12 Os01g0607400_circ_g.13 Os01g0607400_circ_g.14 Os01g0607400_circ_g.15 Os01g0607400_circ_g.16 Os01g0607400_circ_g.17 Os01g0607400_circ_g.18 Os01g0607400_circ_g.20 Os01g0607400_circ_g.21 Os01g0607400_circ_ag.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0607400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21935495 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23945601-23944937(+) 23944797-23945628(-) |
| Potential amino acid sequence |
MLSTTLRLNQVVVQHSLHIFAWTPINDPSGPADLGVKMGFISVLIL*(+) MNPILTPRSAGPEGSFIGVQAKIWRECWTTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |