Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0174900_circ_g.5 |
| ID in PlantcircBase | osa_circ_018163 |
| Alias | Os_ciR1651 |
| Organism | Oryza sativa |
| Position | chr3: 4003371-4003936 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0174900 |
| Parent gene annotation |
Similar to RAPB protein. (Os03t0174900-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0174900_circ_g.6 |
| Support reads | 7/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0174900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013942 |
| PMCS | 0.244118963 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4003884-4003430(+) 4003713-4003924(-) |
| Potential amino acid sequence |
MTRSQAFYDQTESLLCHFNSMCAISRYSTTIERISIWI*(+) MQSLFASTLLKLCDISFLLVLMLGNLDGYTKSDEGKMMSALSLGKSETVYAHSEPDRSQPFGIS YPYADSFYGGAVATYGTHAIKMAQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |