Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0174900_circ_g.5 |
ID in PlantcircBase | osa_circ_018163 |
Alias | Os_ciR1651 |
Organism | Oryza sativa |
Position | chr3: 4003371-4003936 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0174900 |
Parent gene annotation |
Similar to RAPB protein. (Os03t0174900-01) |
Parent gene strand | - |
Alternative splicing | Os03g0174900_circ_g.6 |
Support reads | 7/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0174900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013942 |
PMCS | 0.244118963 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4003884-4003430(+) 4003713-4003924(-) |
Potential amino acid sequence |
MTRSQAFYDQTESLLCHFNSMCAISRYSTTIERISIWI*(+) MQSLFASTLLKLCDISFLLVLMLGNLDGYTKSDEGKMMSALSLGKSETVYAHSEPDRSQPFGIS YPYADSFYGGAVATYGTHAIKMAQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |