Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0350700_circ_g.8 |
ID in PlantcircBase | osa_circ_027513 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 16571261-16571821 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0350700 |
Parent gene annotation |
Conserved hypothetical protein. (Os05t0350700-01);Hypothetical c onserved gene. (Os05t0350700-02) |
Parent gene strand | + |
Alternative splicing | Os05g0350700_circ_g.1 Os05g0350700_circ_g.2 Os05g0350700_circ_g.3 Os05g0350700_circ_g.4 Os05g0350700_circ_g.5 Os05g0350700_circ_g.6 Os05g0350700_circ_g.7 Os05g0350700_circ_g.9 Os05g0350700_circ_g.10 Os05g0350700_circ_g.11 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0350700-02:4 Os05t0350700-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.16030967 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16571770-16571260(+) 16571326-16571618(-) |
Potential amino acid sequence |
MTPPRAGQLKVMKVGSTSKSGRPLIKKMSERKGNARPRHISSNAQLDSPVQSEDDHEELLAAAN SALRSANSSPFWRQVEPFFSYLTTEDIAYLSQQIHLSDDSTASRSIEGDESRKYK*(+) MSRTCIAFALRHLLYQWSSRFTCTSDFHHLQLTCSRWSHPINGSADLNRLYLLLSDN*(-) |
Sponge-miRNAs | osa-miR2095-3p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |