Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0350700_circ_g.8 |
| ID in PlantcircBase | osa_circ_027513 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 16571261-16571821 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0350700 |
| Parent gene annotation |
Conserved hypothetical protein. (Os05t0350700-01);Hypothetical c onserved gene. (Os05t0350700-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0350700_circ_g.1 Os05g0350700_circ_g.2 Os05g0350700_circ_g.3 Os05g0350700_circ_g.4 Os05g0350700_circ_g.5 Os05g0350700_circ_g.6 Os05g0350700_circ_g.7 Os05g0350700_circ_g.9 Os05g0350700_circ_g.10 Os05g0350700_circ_g.11 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0350700-02:4 Os05t0350700-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16030967 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16571770-16571260(+) 16571326-16571618(-) |
| Potential amino acid sequence |
MTPPRAGQLKVMKVGSTSKSGRPLIKKMSERKGNARPRHISSNAQLDSPVQSEDDHEELLAAAN SALRSANSSPFWRQVEPFFSYLTTEDIAYLSQQIHLSDDSTASRSIEGDESRKYK*(+) MSRTCIAFALRHLLYQWSSRFTCTSDFHHLQLTCSRWSHPINGSADLNRLYLLLSDN*(-) |
| Sponge-miRNAs | osa-miR2095-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |