Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0394900_circ_g.2 |
| ID in PlantcircBase | osa_circ_039104 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 13708244-13709729 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os09g0394900 |
| Parent gene annotation |
Similar to Annexin-like protein. (Os09t0394900-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0394900_circ_g.1 Os09g0394900_circ_g.3 Os09g0394900_circ_g.4 |
| Support reads | 16 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0394900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018465 |
| PMCS | 0.153704598 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13708298-13708270(+) 13708289-13709527(-) |
| Potential amino acid sequence |
MQRALIQQEYRTMYSEDLSRRISSELSGHHKKAMLLWILDPAGRDATVLREALSGDTIDLRAAT EIICSRTPSQLQIMKQTYHAKFGTYLEHDIGQRTSGDHQKLLLAYVGIPRYEGPEVDPTIVTHD AKDLYKAGEKRLGTDEKTFIRIFTERSWAHMASVASAYHHMYDRSLEKVVKSETSGNFELALLT ILRCAENPAKYFAKGLAVIVQQL*(+) MSKYIYNCCTITAKPFAKYLAGFSAHLRIVSRASSKFPDVSLFTTFSSDRSYI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |