Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0394900_circ_g.1 |
ID in PlantcircBase | osa_circ_039103 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 13708244-13708839 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0394900 |
Parent gene annotation |
Similar to Annexin-like protein. (Os09t0394900-01) |
Parent gene strand | + |
Alternative splicing | Os09g0394900_circ_g.2 Os09g0394900_circ_g.3 Os09g0394900_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0394900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018464 |
PMCS | 0.293530607 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13708776-13708253(+) 13708298-13708270(+) |
Potential amino acid sequence |
MQNLVLILSTTLVSAHQATIRRVWL*(+) MQRALIQQEYRTMYSEDLSRRISSELSGHHKKAMLLWILDPAGRDATVLREALSGDTIDLRAAT EIICSRTPSQLQIMKQTYHAKFGTYLEHDIGQRTSGDHQKGLAVIVQQL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |