Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G66810_circ_g.4 |
| ID in PlantcircBase | ath_circ_046224 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 26674466-26674564 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | circRNA_finder |
| Parent gene | AT5G66810 |
| Parent gene annotation |
CTLH, C-terminal LisH motif (InterPro:IPR006595) |
| Parent gene strand | + |
| Alternative splicing | AT5G66810_circ_g.1 AT5G66810_circ_g.2 AT5G66810_circ_g.3 AT5G66810_circ_g.5 |
| Support reads | 2 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G66810.4:1 AT5G66810.2:1 AT5G66810.3:1 AT5G66810.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.17929335 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26674526-26674561(+) 26674490-26674468(-) |
| Potential amino acid sequence |
MKFAKGDLFQAFQVDIQALAHAVELTRQGAVDSMKFAKGDLFQAFQVDIQALAHAVELTRQGAV DSMKFAKGDLFQAFQVDIQALAHAVELTRQGAVDSMKFAKGDLFQAFQ(+) MSKSLYIHLECLEKVTFGKFHTINSTLSSELNRMSKSLYIHLECLEKVTFGKFHTINSTLSSEL NRMSKSLYIHLECLEKVTFGKFHTINSTLSSELNRMSKSLYIH(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |