Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0641200_circ_g.3 |
| ID in PlantcircBase | osa_circ_009872 |
| Alias | Os_ciR7152 |
| Organism | Oryza sativa |
| Position | chr11: 25395632-25398263 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0641200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os11t0641200-01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0641200_circ_g.1 Os11g0641200_circ_g.2 Os11g0641200_circ_g.4 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0641200-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006585 |
| PMCS | 0.122954258 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25396861-25396208(+) |
| Potential amino acid sequence |
METAALEHIGRWCPGLLELSLIYCPRIQDSAFLEVGRGCSLLRSLYLVDCSRISDDALCYIAQG CKNLTELSIRRGYEIGDKALISFAENCKSLRELTLQFCERVSDAGLTAIAEGCPLRKLNLCGCQ LITDNGLTAIARGCPDLVYLDISVLRACYIGDPGLIAIGEGCKLLRNLNLRFVEGTSDEGLIGL IKNCGQSLVSLGVATCAWMTDASLHAVGSHCPNLEFLSLESDHIKNEGVVSVAKGCRLLKTLKL QCMGAGDEALDAIGLFCSFLESLSLNNFEKFTDSSVKSLCAGQKGRVLPSYMELDIGYKMLD*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |