Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0641200_circ_g.1 |
ID in PlantcircBase | osa_circ_009870 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 25395050-25397734 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0641200 |
Parent gene annotation |
Hypothetical conserved gene. (Os11t0641200-01) |
Parent gene strand | + |
Alternative splicing | Os11g0641200_circ_g.2 Os11g0641200_circ_g.3 Os11g0641200_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0641200-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.122915816 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25396861-25395173(+) 25395254-25397706(-) |
Potential amino acid sequence |
METAALEHIGRWCPGLLELSLIYCPRIQDSAFLEVGRGCSLLRSLYLVDCSRISDDALCYIAQG CKNLTELSIRRGYEIGDKALISFAENCKSLRELTLQFCERCMMLVLLGAVGGCPAAQISERTCP HFHWTSRAVIMRQSALA*(+) MEEHHTRLSFSSPLQPLARLVNPTSVKQVRSVSLSLPGWSNGNGDMCAPKFELRDILLRRPEGL TSYISHKIGVLTL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |