Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G36930_circ_g.1 |
| ID in PlantcircBase | ath_circ_016970 |
| Alias | At_ciR120, AT2G36930_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 15510368-15510719 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, CIRI-full, PcircRNA_finder, circRNA_finder, find_circ, circseq_cup, CIRI2 |
| Parent gene | AT2G36930 |
| Parent gene annotation |
Expressed protein |
| Parent gene strand | - |
| Alternative splicing | AT2G36930_circ_g.2 AT2G36930_circ_g.3 AT2G36930_circ_g.4 AT2G36930_circ_g.5 |
| Support reads | 50/43 |
| Tissues | leaf/root, aerial, inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G36930.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.715296804 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15510713-15510370(-) |
| Potential amino acid sequence |
MMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLVFTELRKPETEDLPGMGQFNCLLCHRNFSNAS VMDYHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLVFTELRKPETEDLPGM GQFNCLLCHRNFSNASVMDYHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNL VFTELRKPETEDLPGMGQFNCLLCHRNFSNASVMDYHFKTKKHKKRVNMMMGQAPHSQLDADLA GGMGMPDNGPKLMSNLVFTELRKPETEDLPGMGQFNCLLCHRNFSNASVMDYHFKTKKHKK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |