Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G36930_circ_g.1 |
ID in PlantcircBase | ath_circ_016970 |
Alias | At_ciR120, AT2G36930_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 15510368-15510719 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, CIRI-full, PcircRNA_finder, circRNA_finder, find_circ, circseq_cup, CIRI2 |
Parent gene | AT2G36930 |
Parent gene annotation |
Expressed protein |
Parent gene strand | - |
Alternative splicing | AT2G36930_circ_g.2 AT2G36930_circ_g.3 AT2G36930_circ_g.4 AT2G36930_circ_g.5 |
Support reads | 50/43 |
Tissues | leaf/root, aerial, inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G36930.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.715296804 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15510713-15510370(-) |
Potential amino acid sequence |
MMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLVFTELRKPETEDLPGMGQFNCLLCHRNFSNAS VMDYHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLVFTELRKPETEDLPGM GQFNCLLCHRNFSNASVMDYHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNL VFTELRKPETEDLPGMGQFNCLLCHRNFSNASVMDYHFKTKKHKKRVNMMMGQAPHSQLDADLA GGMGMPDNGPKLMSNLVFTELRKPETEDLPGMGQFNCLLCHRNFSNASVMDYHFKTKKHKK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |