Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G36930_circ_g.3 |
ID in PlantcircBase | ath_circ_016972 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 15510543-15511029 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G36930 |
Parent gene annotation |
Expressed protein |
Parent gene strand | - |
Alternative splicing | AT2G36930_circ_g.1 AT2G36930_circ_g.2 AT2G36930_circ_g.4 AT2G36930_circ_g.5 |
Support reads | 17 |
Tissues | inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G36930.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.490141836 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15510713-15510545(-) |
Potential amino acid sequence |
MMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLVFTELRKPETEDLPGMGQFNCLLCHRYFSNVS VRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLVFTELRKPETEDLPGM GQFNCLLCHRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNL VFTELRKPETEDLPGMGQFNCLLCHRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLA GGMGMPDNGPKLMSNLVFTELRKPETEDLPGMGQFNCLLC(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |