Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0128800_circ_g.2 |
| ID in PlantcircBase | osa_circ_010414 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 1372229-1372554 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0128800 |
| Parent gene annotation |
Similar to Arabinoxylan arabinofuranohydrolase isoenzyme AXAH-I. (Os12t0128800-01);Similar to cDNA clone:J033138B08, full insert sequence. (Os12t0128800-02) |
| Parent gene strand | + |
| Alternative splicing | Os12g0128700_circ_g.1 Os12g0128700_circ_g.2 Os12g0128700_circ_g.3 Os12g0128700_circ_igg.1 Os12g0128700_circ_g.2 Os12g0128700_circ_ag.1 Os12g0128700_circ_g.2 Os12g0128700_circ_g.3 Os12g0128700_circ_g.4 Os12g0128800_circ_g.1 Os12g0129000_circ_g.1 Os12g0129000_circ_g.2 Os12g0129300_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0128800-01:2 Os12t0128800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123977147 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1372299-1372271(+) 1372500-1372539(-) |
| Potential amino acid sequence |
MARLGHLIILPISMTTIYMKMHPLCFSRRMNLIGHHVMVQRKLSQVLQRHKRGLS*(+) MHFHIYGSHRDRQDDQVAQTSHHSLKLFGCQDKPLLWRCRTWDNFLWTIT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |