Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0538300_circ_g.8 |
ID in PlantcircBase | osa_circ_011877 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 21444676-21446502 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os12g0538300 |
Parent gene annotation |
Dor1-like protein family protein. (Os12t0538300-01) |
Parent gene strand | + |
Alternative splicing | Os12g0538300_circ_g.1 Os12g0538300_circ_g.2 Os12g0538300_circ_g.3 Os12g0538300_circ_g.4 Os12g0538300_circ_g.5 Os12g0538300_circ_g.6 Os12g0538300_circ_g.7 Os12g0538300_circ_g.9 Os12g0538300_circ_g.10 |
Support reads | 2 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0538300-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.155580784 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21445650-21444850(+) |
Potential amino acid sequence |
MVGYHRTHLFDVVNQYRAIFNNDKSGSDENYDGGLLFSWAMHQISNHLTTLQVMLPNITEGGSL SNIREQCMYCAMGLGLVGLDFRGLLPPIFEKAVLNLFSKNMGTAVENFQVVLDSHRWVPMPSVG FVANGVVDETSDDVTPPSVLMEHPPLAVFVNDVYEMGTMMRHLTWKPLLVKYQSCTLIYLLSKA *(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |