Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0538300_circ_g.8 |
| ID in PlantcircBase | osa_circ_011877 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 21444676-21446502 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os12g0538300 |
| Parent gene annotation |
Dor1-like protein family protein. (Os12t0538300-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0538300_circ_g.1 Os12g0538300_circ_g.2 Os12g0538300_circ_g.3 Os12g0538300_circ_g.4 Os12g0538300_circ_g.5 Os12g0538300_circ_g.6 Os12g0538300_circ_g.7 Os12g0538300_circ_g.9 Os12g0538300_circ_g.10 |
| Support reads | 2 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0538300-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.155580784 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21445650-21444850(+) |
| Potential amino acid sequence |
MVGYHRTHLFDVVNQYRAIFNNDKSGSDENYDGGLLFSWAMHQISNHLTTLQVMLPNITEGGSL SNIREQCMYCAMGLGLVGLDFRGLLPPIFEKAVLNLFSKNMGTAVENFQVVLDSHRWVPMPSVG FVANGVVDETSDDVTPPSVLMEHPPLAVFVNDVYEMGTMMRHLTWKPLLVKYQSCTLIYLLSKA *(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |