Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0503400_circ_g.5 |
| ID in PlantcircBase | osa_circ_001852 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 17458200-17458770 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0503400 |
| Parent gene annotation |
Similar to (Rice Genome Annotation Project) metal transporter Nr amp6. (Os01t0503400-01);Similar to cDNA clone:J013164K10, full i nsert sequence. (Os01t0503400-02);Similar to OsNramp1 (Integral membrane protein). (Os01t0503400-03);Similar to (Rice Genome Ann otation Project) metal transporter Nramp6. (Os01t0503400-04);Sim ilar to cDNA clone:J013164K10, full insert sequence. (Os01t05034 00-05) |
| Parent gene strand | - |
| Alternative splicing | Os01g0503400_circ_g.1 Os01g0503400_circ_g.2 Os01g0503400_circ_g.3 Os01g0503400_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0503400-05:2 Os01t0503400-03:2 Os01t0503400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.231332925 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17458763-17458202(-) |
| Potential amino acid sequence |
MEFTISVLMLVMATCFFMELGKVNPPAGGVIEGLFIPRPKGDYSTSDAVAMFGSLVVPHNLFLH SSLVLTRKMPYTSKGRKARKMEFTISVLMLVMATCFFMELGKVNPPAGGVIEGLFIPRPKGDYS TSDAVAMFGSLVVPHNLFLHSSLVLTRKMPYTSKGRKARKMEFTISVLMLVMATCFFMELGKVN PPAGGVIEGLFIPRPKGDYSTSDAVAMFGSLVVPHNLFLHSSLVLTRKMPYTSKGRKARKMEFT ISVLMLVMATCFFMELGKVNPPAGGVIEGLFIPRPKGDYSTSDAVAMFGSLVVPHNLFLHSSLV LTRKMPYTSKGRK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |