Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0163800_circ_g.7 |
| ID in PlantcircBase | osa_circ_010563 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 3238580-3241348 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0163800 |
| Parent gene annotation |
Similar to ATP binding protein. (Os12t0163800-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0163800_circ_g.4 Os12g0163800_circ_g.5 Os12g0163800_circ_g.6 Os12g0163800_circ_g.8 Os12g0163800_circ_g.9 Os12g0163800_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0163800-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120936812 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3240301-3238644(+) 3240291-3238860(+) 3239089-3241346(-) |
| Potential amino acid sequence |
MMCPALQRDHHHHQPHLQMRQSHMSDPLLQSVIMQNCGGFVHAPMNRTTLVC*(+) MCAYDVSCLTERSSPSSAPSSDASESYVGSTSSISNYAKLWWFCACTNESHNISMLNFP*(+) MGGMIASGSCGDLYHGTYLGEDVAVKILRSEHLNKNVWNEFTQEVYILREVQHTNVVRFIGACT KPPQFCIITD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |