Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0962600_circ_g.2 |
ID in PlantcircBase | osa_circ_005942 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 42425849-42426750 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0962600 |
Parent gene annotation |
Similar to 40S ribosomal protein S10-1. (Os01t0962600-01) |
Parent gene strand | - |
Alternative splicing | Os01g0962600_circ_g.1 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0962650-00:2 Os01t0962600-01:2 Os01t0962650-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002701* |
PMCS | 0.307847201 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
42426596-42426698(-) 42426669-42426678(-) |
Potential amino acid sequence |
MMALSTSAATSTCHLRLCLTPSRSLPSPRLAHSALALLVTAPEARLALRVTGPGLVTGMVTGVA HVVLQVILVARRVVLQLSSSHLLGGSLVCQEGLQPGQAPKG*(-) MQSFKSKEYVRETFSWQHYYWYLTNDGIEHLRSYLNLPSEVVPNTLKKSAKPPSRPFGSGPPGD RPRGPPRFEGDRPRFGDRDGYRGGPRGAPGDFGGEKGGAPAEFQPSFRRESCMPRRTTTWPSTQ RLMCPTWR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |