Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA000060_circ_g.1 |
| ID in PlantcircBase | osi_circ_002701 |
| Alias | 1:46500195|46501109 |
| Organism | Oryza sativa ssp. indica |
| Position | chr1: 46500195-46501109 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA000060 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA000060_circ_g.2 BGIOSGA000060_circ_igg.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA000060-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_005942* osa_circ_023845 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
46500955-46501057(-) 46501028-46501037(-) |
| Potential amino acid sequence |
MMALSTSAATSTCHLRLCLTPSRSLPSPRLAHSALALLVTAPEARLALRVTGPGLVTGMVTGVA HVVLQVILVARRVVLQLSSSHLLGGSLVCQEGLQPGQAPKG*(-) MQSFKSKEYVRETFSWQHYYWYLTNDGIEHLRSYLNLPSEVVPNTLKKSAKPPSRPFGSGPPGD RPRGPPRFEGDRPRFGDRDGYRGGPRGAPGDFGGEKGGAPAEFQPSFRRESCMPRRTTTWPSTQ RLMCPTWR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |