Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0445600_circ_g.10 |
ID in PlantcircBase | osa_circ_033629 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 15209312-15209998 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0445600 |
Parent gene annotation |
Conserved hypothetical protein. (Os07t0445600-01);Conserved hypo thetical protein. (Os07t0445600-02) |
Parent gene strand | - |
Alternative splicing | Os07g0445600_circ_g.8 Os07g0445600_circ_g.9 Os07g0445600_circ_g.11 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0445600-01:2 Os07t0445600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.238330252 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15209988-15209995(+) |
Potential amino acid sequence |
MIFYLVYNNSLICIRAVIRSCTFVAFSQFSSMIFYLVYNNSLICIRAVIRSCTFVAFSQFSSMI FYLVYNNSLICIRAVIRSCTFVAFSQFSSMIFY(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |