Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0596600_circ_g.5 |
| ID in PlantcircBase | osa_circ_034633 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 24295210-24296096 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0596600 |
| Parent gene annotation |
Similar to IBS1 (IMPAIRED IN BABA-INDUCED STERILITY 1); ATP bind ing / kinase/ protein kinase/ protein serine/threonine kinase/ p rotein tyrosine kinase. (Os07t0596600-01);Similar to Cdc2MsC pro tein. (Os07t0596600-02);Similar to predicted protein. (Os07t0596 600-03) |
| Parent gene strand | - |
| Alternative splicing | Os07g0596600_circ_g.2 Os07g0596600_circ_g.3 Os07g0596600_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0596600-01:2 Os07t0596600-02:2 Os07t0596600-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.138784602 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24296083-24295287(+) 24295960-24295942(-) 24295260-24296082(-) |
| Potential amino acid sequence |
MQLLHLCESSRNFASISLLGAYFGRLEGSHA*(+) MPANALRLLETLLSVEPYKRGTASAALTSEFFKTKPYACDPSSLPKYAPNKEMDAKLREDSHRW SNCIRFLSYVVPLLMSTGRSQSCLMRQYSNHIVLIKVPFKMFLKKCQQMH*(-) MHPTRRWMQNYEKIHTGGATA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |