Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0242700_circ_g.3 |
ID in PlantcircBase | osa_circ_036453 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 8669753-8670287 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0242700 |
Parent gene annotation |
Similar to uridylyltransferase-related. (Os08t0242700-01);Simila r to uridylyltransferase-related. (Os08t0242700-02) |
Parent gene strand | - |
Alternative splicing | Os08g0242700_circ_g.1 Os08g0242700_circ_g.2 Os08g0242700_circ_igg.1 Os08g0242700_circ_g.2 Os08g0242700_circ_g.4 Os08g0242700_circ_g.5 Os08g0242700_circ_g.6 Os08g0242700_circ_g.7 Os08g0242700_circ_g.8 Os08g0242700_circ_g.9 Os08g0242700_circ_g.10 Os08g0242700_circ_g.11 Os08g0242700_circ_g.12 Os08g0242700_circ_g.13 Os08g0242700_circ_g.14 Os08g0242700_circ_g.15 Os08g0242700_circ_g.16 Os08g0242700_circ_g.17 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0242700-02:2 Os08t0242700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.178079361 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8670257-8669918(+) 8669943-8670068(-) |
Potential amino acid sequence |
MSMWVAMSTSTSVSNSPDWTVMLMSSMILTRSTNKPGRSAVSTTSKLKWNKYMKQMNEILLASQ IQ*(+) MVNGMLDYCICDASKISFICFIYLFHFSLLVVETADRPGLLVDLVKIIDDINITVQSGEFDTEV DVDIATHIDIYDDGPDRRYDLCLALCFIPQIVRKIHIFFYHQNNMLLDWKIDCSSLVKAYVIKR VADPGGRI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |