Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0242700_circ_g.2 |
| ID in PlantcircBase | osa_circ_036452 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 8669603-8670287 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0242700 |
| Parent gene annotation |
Similar to uridylyltransferase-related. (Os08t0242700-01);Simila r to uridylyltransferase-related. (Os08t0242700-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0242700_circ_g.1 Os08g0242700_circ_g.2 Os08g0242700_circ_igg.1 Os08g0242700_circ_g.3 Os08g0242700_circ_g.4 Os08g0242700_circ_g.5 Os08g0242700_circ_g.6 Os08g0242700_circ_g.7 Os08g0242700_circ_g.8 Os08g0242700_circ_g.9 Os08g0242700_circ_g.10 Os08g0242700_circ_g.11 Os08g0242700_circ_g.12 Os08g0242700_circ_g.13 Os08g0242700_circ_g.14 Os08g0242700_circ_g.15 Os08g0242700_circ_g.16 Os08g0242700_circ_g.17 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0242700-02:3 Os08t0242700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.206000949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8670257-8669636(+) 8669943-8670068(-) |
| Potential amino acid sequence |
MSMWVAMSTSTCCKALINGLPL*(+) MVNGMLDYCICDASKISFICFIYLFHFSLLVVETADRPGLLVDLVKIIDDINITVQSGEFDTEG LLAKAKFHVSYRGKPLIKALQQVDVDIATHIDIYDDGPDRRYDLCLALCFIPQIVRKIHIFFYH QNNMLLDWKIDCSSLVKAYVIKRVADPGGRI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |