Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G06880_circ_g.6 |
| ID in PlantcircBase | ath_circ_020187 |
| Alias | AT3G06880_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 2172734-2172979 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, CIRI-full, CIRI2 |
| Parent gene | AT3G06880 |
| Parent gene annotation |
Transducin/WD40 repeat-like superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT3G06880_circ_g.5 AT3G06880_circ_g.7 |
| Support reads | 21 |
| Tissues | inflorescences, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G06880.1:1 AT3G06880.4:1 AT3G06880.2:1 AT3G06880.5:1 AT3G06880.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.44184959 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2172896-2172736(-) |
| Potential amino acid sequence |
MQLLSTFILANIGGTYSWTGEPYTAAWLMKRGGLTSMSHMNMIRNINWSDECLQDSPPENKKYR NEATRALLDAVTYSEGSNMQLLSTFILANIGGTYSWTGEPYTAAWLMKRGGLTSMSHMNMIRNI NWSDECLQDSPPENKKYRNEATRALLDAVTYSEGSNMQLLSTFILANIGGTYSWTGEPYTAAWL MKRGGLTSMSHMNMIRNINWSDECLQDSPPENKKYRNEATRALLDAVTYSEGSNMQLLSTFILA NIGGTYSWTGEPYTAAWLMKRGGLTSMSHMNMIRNINWSDECLQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |