Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G06880_circ_g.6 |
ID in PlantcircBase | ath_circ_020187 |
Alias | AT3G06880_C1 |
Organism | Arabidpsis thaliana |
Position | chr3: 2172734-2172979 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, CIRI-full, CIRI2 |
Parent gene | AT3G06880 |
Parent gene annotation |
Transducin/WD40 repeat-like superfamily protein |
Parent gene strand | - |
Alternative splicing | AT3G06880_circ_g.5 AT3G06880_circ_g.7 |
Support reads | 21 |
Tissues | inflorescences, whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G06880.1:1 AT3G06880.4:1 AT3G06880.2:1 AT3G06880.5:1 AT3G06880.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.44184959 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2172896-2172736(-) |
Potential amino acid sequence |
MQLLSTFILANIGGTYSWTGEPYTAAWLMKRGGLTSMSHMNMIRNINWSDECLQDSPPENKKYR NEATRALLDAVTYSEGSNMQLLSTFILANIGGTYSWTGEPYTAAWLMKRGGLTSMSHMNMIRNI NWSDECLQDSPPENKKYRNEATRALLDAVTYSEGSNMQLLSTFILANIGGTYSWTGEPYTAAWL MKRGGLTSMSHMNMIRNINWSDECLQDSPPENKKYRNEATRALLDAVTYSEGSNMQLLSTFILA NIGGTYSWTGEPYTAAWLMKRGGLTSMSHMNMIRNINWSDECLQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |