Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0661100_circ_g.1 |
ID in PlantcircBase | osa_circ_035165 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 27869953-27870376 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0661100 |
Parent gene annotation |
Glycosyl transferase, family 4 protein. (Os07t0661100-01) |
Parent gene strand | - |
Alternative splicing | Os07g0661100_circ_g.2 Os07g0661100_circ_g.3 Os07g0661100_circ_g.4 Os07g0661100_circ_g.5 Os07g0661100_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0661100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.177200688 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27869961-27870324(+) 27869997-27870050(-) |
Potential amino acid sequence |
MSSLMQRVLSVHLPNILRNMFTKLPSLVPVNSPVWGSNLGNLCLGQGTNLNSCGTEHRKLRTSG KKKSNNVSLKYEQPYAKGPLCASSKYPKEYVYQVTIFGTRQQSCVGIKPWQPVPWAGNKLKQLW D*(+) MHREDPLHKAAHISARHYCSSFYLRFLTFCAQSHSCLSLFPAQGTGCQGLIPTQDC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |