Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0661100_circ_g.4 |
ID in PlantcircBase | osa_circ_035168 |
Alias | Os_ciR4087 |
Organism | Oryza sativa |
Position | chr7: 27871128-27871629 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0661100 |
Parent gene annotation |
Glycosyl transferase, family 4 protein. (Os07t0661100-01) |
Parent gene strand | - |
Alternative splicing | Os07g0661100_circ_g.1 Os07g0661100_circ_g.2 Os07g0661100_circ_g.3 Os07g0661100_circ_g.5 Os07g0661100_circ_g.6 |
Support reads | 2/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0661100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017441 |
PMCS | 0.31831333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27871392-27871204(+) 27871611-27871547(-) |
Potential amino acid sequence |
MSVEDPMRITLCIKTAADIITVCPTSRPFRPACILIEFVQKTANRSIKSLYREPEMTQNSHHSQ CHSRKIGVGITNENR*(+) MLLLAVFCTNSINIHAGLNGLEVGQTVIISAAVLIHNVMRIGSSTDIEAQQAHAFSIYLVLPFL TTSLALLAFNWYPSSVFVGDTYTYFSGMALAVVGILGHFRFSVQALYAPISSLLYKFDQYTCWP EWS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |