Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0446200_circ_g.2 |
| ID in PlantcircBase | osa_circ_006934 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 16127176-16128164 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0446200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os10t0446200-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0446200_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0446200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.135850354 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16127213-16128088(+) 16127184-16128102(-) 16128065-16128161(-) |
| Potential amino acid sequence |
MVQQFYLPFGLSGKRHLQNGFFTLLVEFLVLYTIHVMWVPGAYYLSVYYRAHLAVCLSNCIKWC SNFTCLLGSPAKGICRMDSLHF*(+) MCPVIHGKIVCTRYPHHMNGIKH*(-) MPFAGEPKRQVKLLHHLMQLERQTARCAL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |