Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d023537_circ_g.3 |
| ID in PlantcircBase | zma_circ_010152 |
| Alias | Zm10circ00010, zma_circ_0003126, GRMZM2G118316_C1 |
| Organism | Zea mays |
| Position | chr10: 9338036-9338573 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d023537 |
| Parent gene annotation |
Chaperone protein dnaJ GFA2 mitochondrial |
| Parent gene strand | + |
| Alternative splicing | Zm00001d023537_circ_g.1 Zm00001d023537_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d023537_T004:3 Zm00001d023537_T001:3 Zm00001d023537_T003:3 Zm00001d023537_T006:3 Zm00001d023537_T002:3 Zm00001d023537_T007:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201035427 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9338222-9338211(+) 9338055-9338510(-) |
| Potential amino acid sequence |
MTSVKYMISLDQKHTSVKRQVVTLEGRVFLGVTHLVTSLVISQRSSILILIKMLMQKKHFKKLT VPMRF*(+) MELLCEITKDVTKWVTPRKTRPSRVTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |