Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d023537_circ_g.3 |
ID in PlantcircBase | zma_circ_010152 |
Alias | Zm10circ00010, zma_circ_0003126, GRMZM2G118316_C1 |
Organism | Zea mays |
Position | chr10: 9338036-9338573 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d023537 |
Parent gene annotation |
Chaperone protein dnaJ GFA2 mitochondrial |
Parent gene strand | + |
Alternative splicing | Zm00001d023537_circ_g.1 Zm00001d023537_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d023537_T004:3 Zm00001d023537_T001:3 Zm00001d023537_T003:3 Zm00001d023537_T006:3 Zm00001d023537_T002:3 Zm00001d023537_T007:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201035427 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9338222-9338211(+) 9338055-9338510(-) |
Potential amino acid sequence |
MTSVKYMISLDQKHTSVKRQVVTLEGRVFLGVTHLVTSLVISQRSSILILIKMLMQKKHFKKLT VPMRF*(+) MELLCEITKDVTKWVTPRKTRPSRVTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |