Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0352400_circ_g.2 |
| ID in PlantcircBase | osa_circ_019837 |
| Alias | Os_ciR8507 |
| Organism | Oryza sativa |
| Position | chr3: 13229066-13231133 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0352400 |
| Parent gene annotation |
Similar to Nucleolar GTP-binding protein 2 (Autoantigen NGP-1). (Os03t0352400-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0352400_circ_g.3 Os03g0352400_circ_g.4 Os03g0352400_circ_g.5 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0352400-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013021 |
| PMCS | 0.159253885 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13229150-13229101(+) 13229087-13230716(-) |
| Potential amino acid sequence |
MFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRCYHLEKHLKENAKHKHLVFLLNKCDLV PAWATKGWLRTLSKDYPTLAFHASINSSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKS SVINTLRSKSVCKVAPIPGETKVWQYITLTKRIFLIDCPGVVYQNNDSETDIVLKGVVRVTNLA DASEHIGEVLRRVKKEHLKRAYKIEDWVDDNDFLVQLSKTTGKLLRVHLRISMLQRSC*(+) MLILKCTLSSFPVVLLSWTRKSLSSTQSSIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |