Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0352400_circ_g.2 |
ID in PlantcircBase | osa_circ_019837 |
Alias | Os_ciR8507 |
Organism | Oryza sativa |
Position | chr3: 13229066-13231133 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0352400 |
Parent gene annotation |
Similar to Nucleolar GTP-binding protein 2 (Autoantigen NGP-1). (Os03t0352400-01) |
Parent gene strand | + |
Alternative splicing | Os03g0352400_circ_g.3 Os03g0352400_circ_g.4 Os03g0352400_circ_g.5 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0352400-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013021 |
PMCS | 0.159253885 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13229150-13229101(+) 13229087-13230716(-) |
Potential amino acid sequence |
MFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRCYHLEKHLKENAKHKHLVFLLNKCDLV PAWATKGWLRTLSKDYPTLAFHASINSSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKS SVINTLRSKSVCKVAPIPGETKVWQYITLTKRIFLIDCPGVVYQNNDSETDIVLKGVVRVTNLA DASEHIGEVLRRVKKEHLKRAYKIEDWVDDNDFLVQLSKTTGKLLRVHLRISMLQRSC*(+) MLILKCTLSSFPVVLLSWTRKSLSSTQSSIL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |