Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0128300_circ_g.5 |
| ID in PlantcircBase | osa_circ_029496 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 1497830-1500263 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0128300 |
| Parent gene annotation |
Mitochondrial half ABC (ATP-binding cassette) transporter, Iron homeostasis, Meristem maintenance (Os06t0128300-01);Similar to S TA1 (STARIK 1); ATPase, coupled to transmembrane movement of sub stances. (Os06t0128300-02);Similar to Mitochondrial half-ABC tra nsporter. (Os06t0128300-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0128300_circ_g.2 Os06g0128300_circ_g.3 Os06g0128300_circ_g.4 Os06g0128300_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0128300-01:5 Os06t0128300-03:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111945614 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1500222-1497864(+) 1498319-1500236(-) |
| Potential amino acid sequence |
MALNVTLEKTAFRSSHSSEGSQLPLC*(+) MVFNVVPTILEIGMVSSILAYKFGSTFAWITSVSVATYIAFTLAVTQWRTKFRTAMNKADNASS TVAVDSLLNYENCEMLSFLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |