Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0619400_circ_g.3 |
| ID in PlantcircBase | osa_circ_020669 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 23487049-23489003 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder |
| Parent gene | Os03g0619400 |
| Parent gene annotation |
Chaperone, tailless complex polypeptide 1 domain containing prot ein. (Os03t0619400-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0619400_circ_g.1 Os03g0619400_circ_g.2 Os03g0619400_circ_g.4 Os03g0619400_circ_g.5 Os03g0619400_circ_g.6 |
| Support reads | 2 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0619400-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139319263 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23487054-23487049(+) 23487229-23488952(-) |
| Potential amino acid sequence |
MERVLKDDAVEEKGERARMAAFIGAMAIADLVKTTLGPKGMDKILQSTGRGRSVTVTNDGATIL KSLHIDNPAAKVLVDISKVQDDEVGDGTTSVVVLAGELLREAEKLVNMKIHPMTIIAGYRMAVE CARNALLERTMDNKENIDKFRSDLMNIAMTTLSSKILSQDKEYFAELAVDAVLRLKGSTNLEAI QILKIPGGSLKDSFLDEG*(+) MKAAILARSPFSSTASSFSTLSIYPSSKKESLRDPPGIFRI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |