Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d041880_circ_g.7 |
ID in PlantcircBase | zma_circ_007654 |
Alias | zma_circ_0001177 |
Organism | Zea mays |
Position | chr3: 142164740-142170331 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d041880 |
Parent gene annotation |
Beta-galactosidase 9 |
Parent gene strand | + |
Alternative splicing | Zm00001d041880_circ_g.6 Zm00001d041880_circ_g.8 Zm00001d041880_circ_g.9 Zm00001d041880_circ_g.10 Zm00001d041880_circ_g.11 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d041880_T010:4 Zm00001d041880_T002:4 Zm00001d041880_T005:4 Zm00001d041880_T001:4 Zm00001d041880_T009:4 Zm00001d041880_T004:4 Zm00001d041880_T006:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.036710013 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
142165049-142164788(+) |
Potential amino acid sequence |
MQEAHVYSSENVHTNGSISGNSQFCSAFLANIDEHKYASVWIFGKSYSLPPWSVSILPDCETVA FNTARVGTQTSFFNVESGSPSYSSRHKPRILSLIGVPYLSTTWWTFKEPVGIWGEGIFTAQGIL EHLNVTKDISDYLSYTTSILVEPILSGQLVVHFR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |