Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA008669_circ_g.5 |
ID in PlantcircBase | osi_circ_004124 |
Alias | 2:27020565|27023969 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 27020565-27023969 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA008669 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA008669_circ_g.4 BGIOSGA008669_circ_g.6 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA008669-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_015703* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27021739-27020580(+) |
Potential amino acid sequence |
MDLFRELGNDYTNSIWEAMLPKEDQGINEFNDAILFIEKPKPTDAFSIKERYIQTKYVDKLLIA KDTNQITIDILEAIRTNDVRAAYHILVLADVSPNMIYDELNNDVHHDPSVTDGKLFDPASCDVK DDSGKPEGCLQGCSLLHIACQYGHSIMAELLLLFGADINKQDFHGRTPLHHCVRRKNDALTKHL LKRCRMEI*(+) |
Sponge-miRNAs | osa-miR2105 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |