Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0263800_circ_g.8 |
ID in PlantcircBase | osa_circ_011047 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 9307763-9309841 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0263800 |
Parent gene annotation |
Similar to cDNA clone:J013002B21, full insert sequence. (Os12t02 63800-01);Similar to cDNA, clone: J065219F05, full insert sequen ce. (Os12t0263800-02);Similar to Isoflavone reductase-like prote in 1. (Os12t0263800-03) |
Parent gene strand | - |
Alternative splicing | Os12g0263200_circ_g.1 Os12g0263200_circ_g.2 Os12g0263200_circ_ag.1 Os12g0263200_circ_ag.2 Os12g0263200_circ_ag.3 Os12g0263200_circ_ag.4 Os12g0263200_circ_ag.5 Os12g0263200_circ_ag.6 Os12g0263200_circ_ag.7 Os12g0263200_circ_ag.8 Os12g0263600_circ_ag.1 Os12g0263600_circ_ag.2 Os12g0263600_circ_ag.3 Os12g0263600_circ_ag.4 Os12g0263600_circ_ag.5 Os12g0263800_circ_g.1 Os12g0263800_circ_g.2 Os12g0263800_circ_g.3 Os12g0263800_circ_g.4 Os12g0263800_circ_g.5 Os12g0263800_circ_g.6 Os12g0263800_circ_g.7 Os12g0263800_circ_g.9 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0263800-03:4 Os12t0263800-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.094125453 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9307809-9309772(-) 9307841-9309804(-) |
Potential amino acid sequence |
MPCAADSIMAVLGAKENQLPFNMALVQLMGFSTRIVLQ*(-) MVHLCWFGSTTCHVLLIVSWRFLGPRKTSCHSIWHWFS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |