Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0263800_circ_g.8 |
| ID in PlantcircBase | osa_circ_011047 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 9307763-9309841 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0263800 |
| Parent gene annotation |
Similar to cDNA clone:J013002B21, full insert sequence. (Os12t02 63800-01);Similar to cDNA, clone: J065219F05, full insert sequen ce. (Os12t0263800-02);Similar to Isoflavone reductase-like prote in 1. (Os12t0263800-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0263200_circ_g.1 Os12g0263200_circ_g.2 Os12g0263200_circ_ag.1 Os12g0263200_circ_ag.2 Os12g0263200_circ_ag.3 Os12g0263200_circ_ag.4 Os12g0263200_circ_ag.5 Os12g0263200_circ_ag.6 Os12g0263200_circ_ag.7 Os12g0263200_circ_ag.8 Os12g0263600_circ_ag.1 Os12g0263600_circ_ag.2 Os12g0263600_circ_ag.3 Os12g0263600_circ_ag.4 Os12g0263600_circ_ag.5 Os12g0263800_circ_g.1 Os12g0263800_circ_g.2 Os12g0263800_circ_g.3 Os12g0263800_circ_g.4 Os12g0263800_circ_g.5 Os12g0263800_circ_g.6 Os12g0263800_circ_g.7 Os12g0263800_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0263800-03:4 Os12t0263800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.094125453 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9307809-9309772(-) 9307841-9309804(-) |
| Potential amino acid sequence |
MPCAADSIMAVLGAKENQLPFNMALVQLMGFSTRIVLQ*(-) MVHLCWFGSTTCHVLLIVSWRFLGPRKTSCHSIWHWFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |