Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G34640_circ_g.1 |
ID in PlantcircBase | ath_circ_034674 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 16539042-16539721 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G34640 |
Parent gene annotation |
Squalene synthase 1 |
Parent gene strand | + |
Alternative splicing | AT4G34640_circ_g.2 AT4G34640_circ_g.3 AT4G34640_circ_g.4 4_circ_ag.5 AT4G34640_circ_g.6 AT4G34640_circ_g.7 4_circ_ag.8 AT4G34640_circ_g.9 AT4G34640_circ_g.10 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G34640.2:4 AT4G34640.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187407047 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16539441-16539718(+) |
Potential amino acid sequence |
MDQFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVCVFYLVLRALDTVEDDTSIPTDE KVPILIAFHRHIYDTDWHYSCGTKEYKILMDQFHHVSAAFLELEKGYQEAIEEITRRMGAGMAK FICQEVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYKILMDQFHH VSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVCVFYLVLRALDTVEDDTSIPTDEKVPILI AFHRHIYDTDWHYSCGTKEYKILMDQFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQE( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |