Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G34640_circ_g.1 |
| ID in PlantcircBase | ath_circ_034674 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16539042-16539721 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G34640 |
| Parent gene annotation |
Squalene synthase 1 |
| Parent gene strand | + |
| Alternative splicing | AT4G34640_circ_g.2 AT4G34640_circ_g.3 AT4G34640_circ_g.4 4_circ_ag.5 AT4G34640_circ_g.6 AT4G34640_circ_g.7 4_circ_ag.8 AT4G34640_circ_g.9 AT4G34640_circ_g.10 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G34640.2:4 AT4G34640.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187407047 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16539441-16539718(+) |
| Potential amino acid sequence |
MDQFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVCVFYLVLRALDTVEDDTSIPTDE KVPILIAFHRHIYDTDWHYSCGTKEYKILMDQFHHVSAAFLELEKGYQEAIEEITRRMGAGMAK FICQEVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYKILMDQFHH VSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVCVFYLVLRALDTVEDDTSIPTDEKVPILI AFHRHIYDTDWHYSCGTKEYKILMDQFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQE( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |