Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0630900_circ_g.1 |
| ID in PlantcircBase | osa_circ_025499 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 32091812-32092303 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0630900 |
| Parent gene annotation |
Similar to H0105C05.3 protein. (Os04t0630900-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0630100_circ_ag.1 Os04g0630400_circ_g.1 Os04g0630600_circ_ag.1 Os04g0630600_circ_ag.2 Os04g0630600_circ_ag.3 Os04g0630600_circ_ag.4 Os04g0630800_circ_ag.1 Os04g0630800_circ_ag.2 Os04g0630900_circ_ag.1 Os04g0630900_circ_ag.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0630900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.313826778 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32091954-32092285(-) 32092012-32092061(-) |
| Potential amino acid sequence |
MADAALQRTEGDGGRRRCQNHALHRAGSQARSHHVQGSLDAGFNHLFQTARRA*(-) MVASLSSGSRRRTRTTRPGHGRRRLAADGGRRRPPTMSESRASPCRLSGTISSRSGFLGRRLQS SLSDSKESVVGMLVVVNGVGAAPKVNTGSTVMRLMSFSSANLHAAFSKSTFETPYACKTQTQKQ WGVLASASRHFHQPGKKCI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |